Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD276 (28-238) Mouse anti-Human, Clone: 7C10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CD276.

Manufacturer:  Abnova Corporation H00080381M09

Catalog No. 89-933-764


Add to cart

Description

Description

Costimulatory B7 molecules (e.g., B7-1, or CD80; MIM 112203) signal through CD28 (MIM 186760) family molecules such as CD28, CTLA4 (MIM 123890), and ICOS (MIM 604558).[supplied by OMIM]

Sequence: ALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTIT
Specifications

Specifications

CD276 (28-238)
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
BC062581.1
B7-H3/B7H3
Mouse
IgG1,kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
80381
Human
ELISA, Immunofluorescence, Western Blot
7C10
Mouse monoclonal antibody raised against a partial recombinant CD276.
CD276
Purified
CD276
CD276 (AAH62581.1,28 a.a. ∽ 238 a.a) partial recombinant protein.
Protein A/G purification
RUO
Antibody
Monoclonal
Antibody Reactive Against Recombinant Protein.
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit