Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD300A Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against partial recombinant human CD300A.

Manufacturer:  Abnova Corporation PAB29578

Catalog No. 89-933-778



Description

Description

The CMRF35 antigen (CMRF35A; MIM 606786), which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes. CMRF35H is recognized by the same antibody and is distinct from CMRF35 (Green et al., 1998 [PubMed 9701027]).[supplied by OMIM]

Sequence: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK
Specifications

Specifications

CD300A
Unconjugated
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) The optimal working dilution should be determined by the end user.
Liquid
CD300A
Recombinant protein corresponding to amino acids 98-149 of human CD300A.
Antigen affinity purification
RUO
Primary
11314
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against partial recombinant human CD300A.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
CMRF-35-H9/CMRF-35H/CMRF35H/CMRF35H9/IGSF12/IRC1/IRC2/IRp60
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit