Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD300C Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against partial recombinant human CD300C.

Manufacturer:  Abnova Corporation PAB29581

Catalog No. 89-933-779


Add to cart

Description

Description

The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).[supplied by OMIM]

Sequence: PWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR
Specifications

Specifications

CD300C
Unconjugated
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Liquid
CD300C
Recombinant protein corresponding to amino acids 115-183 of human CD300C.
Antigen affinity purification
RUO
Primary
10871
Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against partial recombinant human CD300C.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
CMRF-35A/CMRF35/CMRF35A/CMRF35A1/IGSF16/LIR
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit