Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD40 Ligand/TNFSF5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CD40 Ligand/TNFSF5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15918620
|
Novus Biologicals
NBP15918620UL |
20 μL |
Each for $152.22
|
|
NBP159186
|
Novus Biologicals
NBP159186 |
100 μL |
Each for $436.00
|
|
Description
CD40 Ligand/TNFSF5 Polyclonal specifically detects CD40 Ligand/TNFSF5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD40 Ligand/TNFSF5 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Apoptosis, Asthma, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors | |
| CD154, CD154 antigen, CD40 antigen ligand, CD40 ligand, CD40-L, CD40LIGM, gp39, hCD40L, HIGM1, T-B cell-activating molecule, T-BAM, T-cell antigen Gp39, TNF-related activation protein, TNFSF5IMD3, TRAPtumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome), tumor necrosis factor (ligand) superfamily member 5, Tumor necrosis factor ligand superfamily member 5 | |
| CD40LG | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| P29965 | |
| 959 | |
| Synthetic peptides corresponding to CD40LG(CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome)) The peptide sequence was selected from the middle region of CD40LG. Peptide sequence ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title