Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD40 Ligand/TNFSF5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CD40 Ligand/TNFSF5
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15918620
View Documents
Novus Biologicals
NBP15918620UL
20 μL
Each for $152.22
Add to cart
 
NBP159186
View Documents
Novus Biologicals
NBP159186
100 μL
Each for $436.00
Add to cart
 
Description

Description

CD40 Ligand/TNFSF5 Polyclonal specifically detects CD40 Ligand/TNFSF5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

CD40 Ligand/TNFSF5
Polyclonal
Rabbit
Adaptive Immunity, Apoptosis, Asthma, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors
CD154, CD154 antigen, CD40 antigen ligand, CD40 ligand, CD40-L, CD40LIGM, gp39, hCD40L, HIGM1, T-B cell-activating molecule, T-BAM, T-cell antigen Gp39, TNF-related activation protein, TNFSF5IMD3, TRAPtumor necrosis factor (ligand) superfamily, member 5 (hyper-IgM syndrome), tumor necrosis factor (ligand) superfamily member 5, Tumor necrosis factor ligand superfamily member 5
CD40LG
IgG
Affinity Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
P29965
959
Synthetic peptides corresponding to CD40LG(CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome)) The peptide sequence was selected from the middle region of CD40LG. Peptide sequence ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit