Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CD83 Rabbit anti-Human, Polyclonal , Abnova™

CD83 polyclonal antibody raised against recombinant human CD83.

Manufacturer:  Abnova Corporation PAB29493

Catalog No. 89-933-872


Add to cart

Description

Description

Sequence: PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET
Specifications

Specifications

CD83
Unconjugated
Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.
Liquid
CD83
Recombinant protein corresponding to amino acids of human CD83.
Antigen affinity purification
RUO
Primary
9308
Immunofluorescence, Immunohistochemistry (PFA fixed)
CD83 polyclonal antibody raised against recombinant human CD83.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
BL11/HB15
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit