CD99-L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179854

Catalog No. NBP179854

Description

CD99-L2 Polyclonal specifically detects CD99-L2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CD99-L2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CD99 antigen, CD99 antigen-like 2, CD99 antigen-like protein 2, CD99 molecule-like 2, CD99B, DKFZp761H2024, MIC2 like 1, MIC2L1, MIC2-like protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 86%; Rabbit: 86%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_604395
• Gene Symbols: CD99L2
• Immunogen: Synthetic peptide directed towards the middle region of human CD99L2The immunogen for this antibody is CD99L2. Peptide sequence RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83692
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.