Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CD99-L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | CD99-L2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179854
|
Novus Biologicals
NBP179854 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
CD99-L2 Polyclonal specifically detects CD99-L2 in Human samples. It is validated for Western Blot.Specifications
| CD99-L2 | |
| Polyclonal | |
| Rabbit | |
| NP_604395 | |
| 83692 | |
| Synthetic peptide directed towards the middle region of human CD99L2The immunogen for this antibody is CD99L2. Peptide sequence RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CD99 antigen, CD99 antigen-like 2, CD99 antigen-like protein 2, CD99 molecule-like 2, CD99B, DKFZp761H2024, MIC2 like 1, MIC2L1, MIC2-like protein 1 | |
| CD99L2 | |
| IgG | |
| 23 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title