Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDC42EP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15315020UL

 View more versions of this product

Catalog No. NBP15315020


Add to cart

Description

Description

CDC42EP4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CDC42EP4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CDC42EP4
Synthetic peptides corresponding to CDC42EP4(CDC42 effector protein (Rho GTPase binding) 4) The peptide sequence was selected from the N terminal of CDC42EP4. Peptide sequence SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ.
38 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 0.2-1 ug/ml
Q9H3Q1
BORG4MGC3740, CDC42 effector protein (Rho GTPase binding) 4, cdc42 effector protein 4, CEP4Binder of Rho GTPases 4, KAIA1777, MGC17125
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
23580
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit