Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDCA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CDCA5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15514320
View Documents
Novus Biologicals
NBP15514320UL
20 μL
Each for $152.22
Add to cart
 
NBP155143
View Documents
Novus Biologicals
NBP155143
100 μL
Each for $436.00
Add to cart
 
Description

Description

CDCA5 Polyclonal specifically detects CDCA5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CDCA5
Polyclonal
Rabbit
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Q96FF9
113130
Synthetic peptides corresponding to CDCA5(cell division cycle associated 5) The peptide sequence was selected from the middle region of CDCA5. Peptide sequence RRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
cell division cycle associated 5, Cell division cycle-associated protein 5, MGC16386, p35, SORORIN
CDCA5
IgG
Affinity Purified
28 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit