Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDK4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP23228820UL

 View more versions of this product

Catalog No. NBP23228820


Add to cart

Description

Description

CDK4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.
Specifications

Specifications

CDK4
Unconjugated
PBS and 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
CDK4
Synthetic peptide within the following C-term region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
34 kDa
20 ul
Cancer, Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Protein Kinase, Stem Cell Markers
Primary
1019
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 1:2000, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
P11802
Cell division protein kinase 4, CMM3, cyclin-dependent kinase 4, EC 2.7.11, EC 2.7.11.22, melanoma cutaneous malignant, 3, MGC14458, PSK-J3cell division kinase 4
Rabbit
IgG
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit