Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDK5RAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CDK5RAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15824620
|
Novus Biologicals
NBP15824620UL |
20 μL |
Each for $152.22
|
|
NBP158246
|
Novus Biologicals
NBP158246 |
100 μL |
Each for $436.00
|
|
Description
CDK5RAP1 Polyclonal specifically detects CDK5RAP1 in Human samples. It is validated for Western Blot.Specifications
| CDK5RAP1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| C20orf34, C42, CDK5 activator-binding protein C42, CDK5 regulatory subunit associated protein 1, CDK5 regulatory subunit-associated protein 1, CDK5RAP1.3, CDK5RAP1.4, CGI-05, chromosome 20 open reading frame 34, HSPC167 | |
| CDK5RAP1 | |
| IgG | |
| Affinity Purified | |
| This product is specific to Subunit or Isoform: -associated protein 1. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 51654 | |
| Synthetic peptides corresponding to CDK5RAP1(CDK5 regulatory subunit associated protein 1) The peptide sequence was selected from the N terminal of CDK5RAP1. Peptide sequence MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title