Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDK5RAP1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17965120UL

 View more versions of this product

Catalog No. NBP1796520


Add to cart

Description

Description

CDK5RAP1 Polyclonal antibody specifically detects Antigen in Rat samples. It is validated for Western Blotting.
Specifications

Specifications

CDK5RAP1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CDK5RAP1
Synthetic peptide directed towards the C terminal of human Cdk5rap1The immunogen for this antibody is Cdk5rap1. Peptide sequence VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD.
65 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Rat
Western Blot
Western Blot 1:1000
NP_663773
C20orf34, C42, CDK5 activator-binding protein C42, CDK5 regulatory subunit associated protein 1, CDK5 regulatory subunit-associated protein 1, CDK5RAP1.3, CDK5RAP1.4, CGI-05, chromosome 20 open reading frame 34, HSPC167
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
51654
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit