Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDK5RAP2 Mouse anti-Human, Clone: , Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP259027

Catalog No. NBP259027


Add to cart

Description

Description

CDK5RAP2 Monoclonal antibody specifically detects CDK5RAP2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

CDK5RAP2
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
C48, CDK5 activator-binding protein C48, CDK5 regulatory subunit associated protein 2, CDK5 regulatory subunit-associated protein 2, centrosomal protein 215 kDa, Centrosome-associated protein 215, Cep215, DKFZp686B1070, DKFZp686D1070, FLJ10867, KIAA1633microcephaly, primary autosomal recessive 3, MCPH3
Mouse
IgG1
100 ul
Cell Cycle and Replication, Cellular Markers, Chromatin Research
Primary
55755
Human
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Purified
CDK5RAP2
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLEKLEKLFLNGKSVGVEMNTQNELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMV
Protein A purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only