Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDKL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156376
Description
CDKL2 Polyclonal specifically detects CDKL2 in Human samples. It is validated for Western Blot.Specifications
CDKL2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CDC2-related kinase, cyclin-dependent kinase-like 2, cyclin-dependent kinase-like 2 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIAMRE, P56, p56 KKIAMRE protein kinase, Protein kinase p56 KKIAMRE, serine/threonine protein kinase KKIAMRE, Serine/threonine-protein kinase KKIAMRE | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Chicken: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q92772 | |
CDKL2 | |
Synthetic peptides corresponding to CDKL2(cyclin-dependent kinase-like 2 (CDC2-related kinase)) The peptide sequence was selected from the N terminal of CDKL2. Peptide sequence MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR. | |
100 μL | |
Protein Kinase | |
8999 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction