Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDKL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CDKL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156376
|
Novus Biologicals
NBP156376 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CDKL2 Polyclonal specifically detects CDKL2 in Human samples. It is validated for Western Blot.Specifications
| CDKL2 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| Q92772 | |
| 8999 | |
| Synthetic peptides corresponding to CDKL2(cyclin-dependent kinase-like 2 (CDC2-related kinase)) The peptide sequence was selected from the N terminal of CDKL2. Peptide sequence MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CDC2-related kinase, cyclin-dependent kinase-like 2, cyclin-dependent kinase-like 2 (CDC2-related kinase), EC 2.7.11, EC 2.7.11.22, KKIAMRE, P56, p56 KKIAMRE protein kinase, Protein kinase p56 KKIAMRE, serine/threonine protein kinase KKIAMRE, Serine/threonine-protein kinase KKIAMRE | |
| CDKL2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title