Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDKL5 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human CDKL5.

Manufacturer:  Abnova Corporation PAB29377

Catalog No. 89-933-923


Add to cart

Description

Description

This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized. [provided by RefSeq]

Sequence: AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP
Specifications

Specifications

CDKL5
Unconjugated
Immunohistochemistry (1:200-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
Liquid
CDKL5
Recombinant protein corresponding to human CDKL5.
Antigen affinity purification
RUO
Primary
6792
Immunofluorescence, Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant human CDKL5.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
ISSX/STK9
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit