CDKN2D Recombinant Protein, Abnova

Human CDKN2D full-length ORF recombinant protein with GST-tag at N-terminal

Manufacturer: Abnova Corporation H00001032P0125

 View more versions of this product

Catalog No. 89-009-973

  Check Availability
Add to Cart

    Specifications

    Cross Reactivity Human
    For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blotting (Recombinant Protein)
    Format Solution
    Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
    Molecular Weight 44.4
    Name Human CDKN2D Full-length ORF Recombinant Protein with GST-tag at N-terminal
    pH Range 8
    Preparation Method In vitro wheat germ expression system
    Purification Method Glutathione Sepharose 4 Fast Flow
    Quality Control Testing 12.5% SDS-PAGE stained with Coomassie Blue
    Quantity 25μg
    Recombinant Yes
    Source Wheat Germ (in vitro)
    Storage Requirements -80°C

    The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported.

    • Theoretical MW (kDa): 44
    • Preparation method: In vitro wheat germ expression system
    • Purification: Glutathione Sepharose 4 fast flow
    • Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

    Sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

    Best use within three months from the date of receipt of this protein.

    ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit