Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDR2L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP19152420UL

 View more versions of this product

Catalog No. NBP19152420


Add to cart

Description

Description

CDR2L Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CDR2L
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
CDR2L
Synthetic peptide directed towards the C terminal of human CDR2L. Peptide sequence VQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPE.
53 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 0.2-1 ug/ml
NP_055418
cerebellar degeneration-related protein 2-like, HUMPPA, paraneoplastic 62 kDa antigen, paraneoplastic antigen
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
30850
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit