Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDRT4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP184559
Description
CDRT4 Polyclonal specifically detects CDRT4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CDRT4 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q8N9R6 | |
CDRT4 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVI | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CMT1A duplicated region transcript 4, CMT1A duplicated region transcript 4 protein, FLJ36674, MGC33988, NBLA10383, putative protein product of Nbla10383 | |
Rabbit | |
Affinity Purified | |
RUO | |
284040 | |
Human | |
IgG |
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction