CDRT4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155440

Catalog No. NBP155440

Description

CDRT4 Polyclonal specifically detects CDRT4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CDRT4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N9R6
• Gene Symbols: CDRT4
• Immunogen: Synthetic peptides corresponding to CDRT4(CMT1A duplicated region transcript 4) The peptide sequence was selected from the middle region of CDRT4. Peptide sequence TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 284040
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CMT1A duplicated region transcript 4, CMT1A duplicated region transcript 4 protein, FLJ36674, MGC33988, NBLA10383, putative protein product of Nbla10383
• Host Species: Rabbit
• Molecular Weight of Antigen: 17 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.