Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDRT4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CDRT4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155440
View Documents
Novus Biologicals
NBP155440
100 μL
Each for $436.00
Add to cart
 
NBP15544020
View Documents
Novus Biologicals
NBP15544020UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

CDRT4 Polyclonal specifically detects CDRT4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CDRT4
Polyclonal
Rabbit
Human
Q8N9R6
284040
Synthetic peptides corresponding to CDRT4(CMT1A duplicated region transcript 4) The peptide sequence was selected from the middle region of CDRT4. Peptide sequence TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
CMT1A duplicated region transcript 4, CMT1A duplicated region transcript 4 protein, FLJ36674, MGC33988, NBLA10383, putative protein product of Nbla10383
CDRT4
IgG
Affinity Purified
17 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit