Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDRT4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CDRT4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155440
|
Novus Biologicals
NBP155440 |
100 μL |
Each for $436.00
|
|
NBP15544020
|
Novus Biologicals
NBP15544020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
CDRT4 Polyclonal specifically detects CDRT4 in Human samples. It is validated for Western Blot.Specifications
| CDRT4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8N9R6 | |
| 284040 | |
| Synthetic peptides corresponding to CDRT4(CMT1A duplicated region transcript 4) The peptide sequence was selected from the middle region of CDRT4. Peptide sequence TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CMT1A duplicated region transcript 4, CMT1A duplicated region transcript 4 protein, FLJ36674, MGC33988, NBLA10383, putative protein product of Nbla10383 | |
| CDRT4 | |
| IgG | |
| Affinity Purified | |
| 17 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title