Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDYL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15517820UL
Description
CDYL2 Polyclonal specifically detects CDYL2 in Human samples. It is validated for Western Blot.Specifications
CDYL2 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q8N8U2 | |
CDYL2 | |
Synthetic peptides corresponding to CDYL2(chromodomain protein, Y-like 2) The peptide sequence was selected from the N terminal of CDYL2 (NP_689555). Peptide sequence NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG. | |
Affinity Purified | |
RUO | |
124359 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CDY-like 2, chromodomain protein, Y-like 2, chromodomain Y-like protein 2, FLJ38866 | |
Rabbit | |
57 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction