Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CEACAM-7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CEACAM7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP168887
View Documents
Novus Biologicals
NBP168887
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CEACAM7 Polyclonal specifically detects CEACAM7 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CEACAM7
Polyclonal
Rabbit
Human
Q14002
1087
Synthetic peptides corresponding to CEACAM7 (carcinoembryonic antigen-related cell adhesion molecule 7) The peptide sequence was selected from the N terminal of CEACAM7. Peptide sequence NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
Carcinoembryonic antigen CGM 2, Carcinoembryonic antigen CGM2, Carcinoembryonic antigen gene family member 2, Carcinoembryonic antigen related cell adhesion molecule 7, CEA, CEACAM 7, CGM 2, CGM2
CEACAM7
IgG
Affinity Purified
29 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit