Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CEACAM-7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CEACAM7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP168887
|
Novus Biologicals
NBP168887 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CEACAM7 Polyclonal specifically detects CEACAM7 in Human samples. It is validated for Western Blot.Specifications
| CEACAM7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q14002 | |
| 1087 | |
| Synthetic peptides corresponding to CEACAM7 (carcinoembryonic antigen-related cell adhesion molecule 7) The peptide sequence was selected from the N terminal of CEACAM7. Peptide sequence NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Carcinoembryonic antigen CGM 2, Carcinoembryonic antigen CGM2, Carcinoembryonic antigen gene family member 2, Carcinoembryonic antigen related cell adhesion molecule 7, CEA, CEACAM 7, CGM 2, CGM2 | |
| CEACAM7 | |
| IgG | |
| Affinity Purified | |
| 29 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title