CEACAM16 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170492

Catalog No. NBP170492

Description

CEACAM16 Polyclonal specifically detects CEACAM16 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CEACAM16
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: carcinoembryonic antigen-related cell adhesion molecule 16
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CEACAM16
• Immunogen: Synthetic peptides corresponding to CEACAM16(carcinoembryonic antigen-related cell adhesion molecule 16) The peptide sequence was selected from the middle region of CEACAM16. Peptide sequence TVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNC The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 388551
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG