Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CENPA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15293720UL
Description
CENPA Polyclonal specifically detects CENPA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CENPA | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Centromere autoantigen A, centromere protein A (17kD), centromere protein ACENP-Acentromere protein A, 17kDa, histone H3-like centromeric protein A | |
Rabbit | |
16 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CENPA | |
Synthetic peptides corresponding to CENPA(centromere protein A) The peptide sequence was selected from the N terminal of CENPA. Peptide sequence MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE. | |
Protein A purified | |
RUO | |
1058 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction