Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CENPA Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CENPA
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15293720
View Documents
Novus Biologicals
NBP15293720UL
20 μL
Each for $152.22
Add to cart
 
NBP152937
View Documents
Novus Biologicals
NBP152937
100 μL
Each for $436.00
Add to cart
 
Description

Description

CENPA Polyclonal specifically detects CENPA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

CENPA
Polyclonal
Purified
RUO
Centromere autoantigen A, centromere protein A (17kD), centromere protein ACENP-Acentromere protein A, 17kDa, histone H3-like centromeric protein A
CENPA
IgG
Protein A purified
16 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
1058
Synthetic peptides corresponding to CENPA(centromere protein A) The peptide sequence was selected from the N terminal of CENPA. Peptide sequence MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit