CENPN Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179664

Catalog No. NBP179664

Description

CENPN Polyclonal specifically detects CENPN in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CENPN
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence 1:10-1:2000
• Gene Accession No.: NP_001094095
• Gene Symbols: CENPN
• Immunogen: Synthetic peptide directed towards the middle region of human CENPNThe immunogen for this antibody is CENPN. Peptide sequence SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BM039, C16orf60, CENP-N, centromere protein N, chromosome 16 open reading frame 60, FLJ13607, FLJ22660, ICEN32, Interphase centromere complex protein 32
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 55839
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.