Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CENPN Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17966420UL
Description
CENPN Polyclonal specifically detects CENPN in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
CENPN | |
Polyclonal | |
Western Blot 1:1000, Immunocytochemistry/Immunofluorescence 1:10-1:2000 | |
NP_001094095 | |
CENPN | |
Synthetic peptide directed towards the middle region of human CENPNThe immunogen for this antibody is CENPN. Peptide sequence SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
BM039, C16orf60, CENP-N, centromere protein N, chromosome 16 open reading frame 60, FLJ13607, FLJ22660, ICEN32, Interphase centromere complex protein 32 | |
Rabbit | |
41 kDa | |
20 μL | |
Stem Cell Markers | |
55839 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title