Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CENPN Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP17966420UL

 View more versions of this product

Catalog No. NBP17966420


Add to cart

Description

Description

CENPN Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blotting.
Specifications

Specifications

CENPN
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
CENPN
Synthetic peptide directed towards the middle region of human CENPNThe immunogen for this antibody is CENPN. Peptide sequence SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS.
41 kDa
20ul
Stem Cell Markers
Primary
55839
Immunocytochemistry, Immunofluorescence, Western Blot
Western Blot 1:1000, Immunocytochemistry/Immunofluorescence 1:10-1:2000
NP_001094095
BM039, C16orf60, CENP-N, centromere protein N, chromosome 16 open reading frame 60, FLJ13607, FLJ22660, ICEN32, Interphase centromere complex protein 32
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit