Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CENPN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $542.50
Specifications
Antigen | CENPN |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17966420
|
Novus Biologicals
NBP17966420UL |
20 μL |
Each for $204.00
|
|
|||||
NBP179664
|
Novus Biologicals
NBP179664 |
100 μL |
Each for $542.50
|
|
|||||
Description
CENPN Polyclonal specifically detects CENPN in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
CENPN | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
BM039, C16orf60, CENP-N, centromere protein N, chromosome 16 open reading frame 60, FLJ13607, FLJ22660, ICEN32, Interphase centromere complex protein 32 | |
CENPN | |
IgG | |
41 kDa |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
NP_001094095 | |
55839 | |
Synthetic peptide directed towards the middle region of human CENPNThe immunogen for this antibody is CENPN. Peptide sequence SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title