CENTD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB432558	Novus Biologicals NBP18454225UL	25 μL
NBP184542	Novus Biologicals NBP184542	0.1 mL

Description

CENTD1 Polyclonal specifically detects CENTD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CENTD1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 116984
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Arf and Rho GAP adapter protein 2, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2, centaurin, delta 1, Centaurin-delta-1, CENTD1arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2, cnt-d1, FLJ13675, FLJ44916, KIAA0580centaurin-delta-1, PARX, Protein PARX
• Gene Symbols: ARAP2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only