Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CEP135 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310683100UL
Description
CEP135 Polyclonal specifically detects CEP135 in Human samples. It is validated for Western Blot.Specifications
CEP135 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
centrosomal protein 135kDa, Centrosomal protein 4centrosomal protein of 135 kDa, Cep135, CEP4, FLJ13621, KIAA0635centrosome protein cep135 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP135 (NP_079285). Peptide sequence REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
9662 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction