Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CEP350 Mouse anti-Human, Clone: , Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP259028

Catalog No. NBP259028


Add to cart

Description

Description

CEP350 Monoclonal antibody specifically detects CEP350 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications

Specifications

CEP350
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
CAP350GM133, centrosomal protein 350kDa, centrosome-associated protein 350, Centrosome-associated protein of 350 kDa, Cep350, FLJ38282, FLJ44058, KIAA0480centrosome associated protein 350
Mouse
IgG1
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Western Blot 1 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200, Western Blot (Negative)
Purified
CEP350
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ
Protein A purified
RUO
Primary
9857
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only