CEP350 Mouse anti-Human, Clone: , Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP259028

Catalog No. NBP259028

Description

CEP350 Monoclonal specifically detects CEP350 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CEP350
• Classification: Monoclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CAP350GM133, centrosomal protein 350kDa, centrosome-associated protein 350, Centrosome-associated protein of 350 kDa, Cep350, FLJ38282, FLJ44058, KIAA0480centrosome associated protein 350
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9857
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CEP350
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

For Research Use Only