Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CEP55 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | CEP55 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP153040
|
Novus Biologicals
NBP153040 |
100 μL |
Each of 1 for $482.50
|
N/A | |||||
Description
CEP55 Polyclonal specifically detects CEP55 in Human samples. It is validated for Western Blot.Specifications
CEP55 | |
Polyclonal | |
Rabbit | |
Q53EZ4 | |
55165 | |
Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the N terminal of CEP55. Peptide sequence MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C10orf3, cancer/testis antigen 111, centrosomal protein 55kDa, centrosomal protein of 55 kDa, Cep55, chromosome 10 open reading frame 3, CT111, FLJ10540, Up-regulated in colon cancer 6, URCC6 | |
CEP55 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title