Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CEP57 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310691100UL
Description
CEP57 Polyclonal specifically detects CEP57 in Human samples. It is validated for Western Blot.Specifications
CEP57 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
centrosomal protein 57kDa, Cep57, FGF2-interacting protein, KIAA0092centrosomal protein of 57 kDa, PIG8, Testis-specific protein 57, Translokin, TSP57proliferation-inducing protein 8 | |
The immunogen is a synthetic peptide directed towards the middle region of Human CEP57. Peptide sequence TIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYM | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
9702 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction