Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CES7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170499
Description
CES7 Polyclonal specifically detects CES7 in Human samples. It is validated for Western Blot.Specifications
CES7 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
carboxylesterase 5A, carboxylesterase 7, CAUXIN, FLJ31547 | |
Rabbit | |
58 kDa | |
100 μL | |
Primary | |
Rat 85%. | |
Human, Rat | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CES5A | |
Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the middle region of CES7. Peptide sequence LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF. | |
Affinity Purified | |
RUO | |
221223 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title