Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CES7 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CES7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170499
|
Novus Biologicals
NBP170499 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CES7 Polyclonal specifically detects CES7 in Human samples. It is validated for Western Blot.Specifications
| CES7 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 221223 | |
| Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the middle region of CES7. Peptide sequence LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| carboxylesterase 5A, carboxylesterase 7, CAUXIN, FLJ31547 | |
| CES5A | |
| IgG | |
| Affinity Purified | |
| 58 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title