Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHERP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CHERP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18045720
|
Novus Biologicals
NBP18045720UL |
20 μL |
Each for $152.22
|
|
NBP180457
|
Novus Biologicals
NBP180457 |
100 μL |
Each for $436.00
|
|
Description
CHERP Polyclonal specifically detects CHERP in Human samples. It is validated for Western Blot.Specifications
| CHERP | |
| Polyclonal | |
| Rabbit | |
| NP_006378 | |
| 10523 | |
| Synthetic peptide directed towards the middle region of human CHERP. Peptide sequence EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| calcium homeostasis endoplasmic reticulum protein, DAN16, DAN26, ERPROT 213-21, ERPROT213-21, protein with polyglutamine repeat, SCAF6, SRA1, SR-related CTD associated factor 6, SR-related CTD-associated factor 6 | |
| CHERP | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title