Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHML Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP276526

Catalog No. NBP276526


Add to cart

Description

Description

CHML Polyclonal antibody specifically detects CHML in Human samples. It is validated for Western Blot,Immunocytochemistry,Immunofluorescence.
Specifications

Specifications

CHML
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
CHML
This antibody was developed against Recombinant Protein corresponding to amino acids: VEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVS
100 μL
Primary
1122
Human
Immunocytochemistry, Immunofluorescence, Western Blot
Western Blot 0.4 μ/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL
Choroideraemia-like protein, choroideremia-like (Rab escort protein 2), FLJ10071, Rab escort protein 2, rab proteins geranylgeranyltransferase component A 2, REP-2, REP-2, Rab escort protein 2, REP2FLJ13361
Rabbit
IgG
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit