Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Chondromodulin-1/LECT1, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP184484

Catalog No. NBP184484


Add to cart

Description

Description

Chondromodulin-1/LECT1 Polyclonal antibody specifically detects Chondromodulin-1/LECT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Chondromodulin-1/LECT1
Unconjugated
Affinity Purified
BRICD3, BRICHOS domain containing 3, CHM1chondromodulin I, CHMI, CHM-I, chondromodulin, chondromodulin-1, chondromodulin-I, leukocyte cell derived chemotaxin 1, Leukocyte cell-derived chemotaxin 1, multiple myeloma tumor suppressor 1, MYETS1
LECT1
This antibody was developed against Recombinant Protein corresponding to amino acids:NGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQ
Polyclonal
Immunogen affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry,Immunohistochemistry (Paraffin)
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
11061
Rabbit
IgG
Primary
0.1 ml
Stem Cell Markers
Human
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only