CHRAC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180334

Catalog No. NBP180334

Description

CHRAC1 Polyclonal specifically detects CHRAC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CHRAC1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_059140
• Gene Symbols: CHRAC1
• Immunogen: Synthetic peptide directed towards the middle region of human CHRAC1. Peptide sequence SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS.
• Quantity: 100 μL
• Research Discipline: Chromatin Research
• Gene ID (Entrez): 54108
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: CHARC1, CHRAC-1, CHRAC-15, CHRAC15CHARC15, chromatin accessibility complex 1, Chromatin accessibility complex 15 kDa protein, DNA polymerase epsilon subunit p15, histone-fold protein CHRAC15, HuCHRAC15, YCL1chromatin accessibility complex protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 75%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Yeast
• Isotype: IgG