Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHRAC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CHRAC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180334
View Documents
Novus Biologicals
NBP180334
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

CHRAC1 Polyclonal specifically detects CHRAC1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CHRAC1
Polyclonal
Rabbit
Chromatin Research
CHARC1, CHRAC-1, CHRAC-15, CHRAC15CHARC15, chromatin accessibility complex 1, Chromatin accessibility complex 15 kDa protein, DNA polymerase epsilon subunit p15, histone-fold protein CHRAC15, HuCHRAC15, YCL1chromatin accessibility complex protein 1
CHRAC1
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_059140
54108
Synthetic peptide directed towards the middle region of human CHRAC1. Peptide sequence SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit