Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHRAC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | CHRAC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180334
|
Novus Biologicals
NBP180334 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
CHRAC1 Polyclonal specifically detects CHRAC1 in Human samples. It is validated for Western Blot.Specifications
| CHRAC1 | |
| Polyclonal | |
| Rabbit | |
| Chromatin Research | |
| CHARC1, CHRAC-1, CHRAC-15, CHRAC15CHARC15, chromatin accessibility complex 1, Chromatin accessibility complex 15 kDa protein, DNA polymerase epsilon subunit p15, histone-fold protein CHRAC15, HuCHRAC15, YCL1chromatin accessibility complex protein 1 | |
| CHRAC1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_059140 | |
| 54108 | |
| Synthetic peptide directed towards the middle region of human CHRAC1. Peptide sequence SETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title