Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHRFAM7A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | CHRFAM7A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180206
|
Novus Biologicals
NBP180206 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
CHRFAM7A Polyclonal specifically detects CHRFAM7A in Human samples. It is validated for Western Blot.Specifications
| CHRFAM7A | |
| Polyclonal | |
| Rabbit | |
| NP_683709 | |
| 89832 | |
| Synthetic peptide directed towards the middle region of human CHRFAM7A. Peptide sequence: DSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLN | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CHRNA7, CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion, CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion, CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid, CHRNA7-FAM7A fusion protein, D-10alpha-7 nicotinic cholinergic receptor subunit, MGC120482, MGC120483 | |
| CHRFAM7A | |
| IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title