Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHRNB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | CHRNB3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17995020
|
Novus Biologicals
NBP17995020UL |
20 μL |
Each for $152.22
|
|
NBP179950
|
Novus Biologicals
NBP179950 |
100 μL |
Each for $436.00
|
|
Description
CHRNB3 Polyclonal specifically detects CHRNB3 in Human samples. It is validated for Western Blot.Specifications
CHRNB3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
acetylcholine receptor, neuronal nicotinic, beta-3 subunit, cholinergic receptor, nicotinic, beta 3, cholinergic receptor, nicotinic, beta polypeptide 3, neuronal acetylcholine receptor subunit beta-3 | |
CHRNB3 | |
IgG | |
Affinity Purified | |
53 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_000740 | |
1142 | |
Synthetic peptide directed towards the middle region of human CHRNB3The immunogen for this antibody is CHRNB3. Peptide sequence YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title