Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHRND Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen CHRND
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126648
View Documents
Novus Biologicals
NBP31087325UL
25 μg
Each for $106.19
Add to cart
 
NB126647
View Documents
Novus Biologicals
NBP310873100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

CHRND Polyclonal antibody specifically detects CHRND in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

CHRND
Western Blot, Immunohistochemistry
Purified
RUO
Human
acetylcholine receptor subunit delta, ACHRDSCCMS, cholinergic receptor, nicotinic, delta, cholinergic receptor, nicotinic, delta polypeptide, CMS2A, FCCMS
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRND (NP_000742). Peptide sequence LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Hypoxia
PBS buffer, 2% sucrose
1144
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit