Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen CHT1
Immunogen Synthetic peptides corresponding to SLC5A7(solute carrier family 5 (choline transporter), member 7) The peptide sequence was selected from the middle region of SLC5A7. Peptide sequence DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP162339 View Documents Novus BiologicalsSupplier Diversity Partner
NBP162339
100 ul This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.
N/A
Description

Description

CHT1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

CHT1
Rabbit
Polyclonal
Unconjugated
60482
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to SLC5A7(solute carrier family 5 (choline transporter), member 7) The peptide sequence was selected from the middle region of SLC5A7. Peptide sequence DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV.
Primary
IgG
CHT, CHT1MGC126299, hCHT, Hemicholinium-3-sensitive choline transporter, high affinity choline transporter 1, high affinity choline transporter; hemicholinium-3-sensitive cholinetransporter, MGC126300, solute carrier family 5 (choline transporter), member 7, Solute carrier family 5 member 7
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit