Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Chymotrypsin-like protease Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158056
Description
Chymotrypsin-like protease Polyclonal specifically detects Chymotrypsin-like protease in Human samples. It is validated for Western Blot.Specifications
Chymotrypsin-like protease | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
P40313 | |
CTRL | |
Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 84%; Rat: 84%. | |
Human, Mouse, Rat, Porcine, Canine | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
chymotrypsin-like, chymotrypsin-like protease CTRL-1, CTRL1, EC 3.4.21, EC 3.4.21.-, MGC70821 | |
Rabbit | |
Affinity Purified | |
RUO | |
1506 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title