Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Chymotrypsin-like protease Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Chymotrypsin-like protease |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP158002
|
Novus Biologicals
NBP158002 |
100 μL |
Each of 1 for $436.00
|
|
Description
Chymotrypsin-like protease Polyclonal specifically detects Chymotrypsin-like protease in Human samples. It is validated for Western Blot.Specifications
Chymotrypsin-like protease | |
Polyclonal | |
Rabbit | |
P40313 | |
1506 | |
Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
chymotrypsin-like, chymotrypsin-like protease CTRL-1, CTRL1, EC 3.4.21, EC 3.4.21.-, MGC70821 | |
CTRL | |
IgG | |
Affinity Purified | |
28 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title