Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Citron Kinase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP257994

Catalog No. NBP257994


Add to cart

Description

Description

Citron Kinase Polyclonal antibody specifically detects Citron Kinase in Human samples. It is validated for Immunocytochemistry, Immunofluorescence.
Specifications

Specifications

Citron Kinase
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
CITK, citron (rho-interacting, serine/threonine kinase 21), Citron Rho-Interacting Kinase, Citron Rho-Interacting Serine/Threonine Kinase, CRIK, KIAA0949, MCPH17, Rho-interacting Serine/Threonine kinase 21, serine/threonine kinase 21, Serine/threonine-protein kinase 21, STK21
Rabbit
IgG
100 ul
Protein Kinase
Primary
11113
Human
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
CIT
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ERSDLEYQLENIQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNELKLALEKEKARCA
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only