Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

CIZ1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen CIZ1
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125882
View Documents
Novus Biologicals
NBP31049025UL
25 μg
Each for $106.19
N/A
NB125881
View Documents
Novus Biologicals
NBP310490100UL
100 μg
Each for $320.71
N/A
Description

Description

CIZ1 Polyclonal antibody specifically detects CIZ1 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

CIZ1
Western Blot, Immunohistochemistry
Purified
RUO
Human
CDKN1A interacting zinc finger protein 1, CDKN1A-interacting zinc finger protein 1, cip1-interacting zinc finger protein, LSFR1ZNF356Nuclear protein NP94, NP94, Zinc finger protein 356
The immunogen is a synthetic peptide directed towards the C terminal region of human CIZ1 (NP_036259). Peptide sequence YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Cancer
PBS buffer, 2% sucrose
25792
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit