Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CKI gamma 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen CKI gamma 3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15757320
View Documents
Novus Biologicals
NBP15757320UL
20 μL
Each for $152.22
Add to cart
 
NBP157573
View Documents
Novus Biologicals
NBP157573
100 μL
Each for $436.00
Add to cart
 
Description

Description

CKI gamma 3 Polyclonal specifically detects CKI gamma 3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

CKI gamma 3
Polyclonal
Rabbit
Protein Kinase
Q9Y6M4
1456
Synthetic peptides corresponding to CSNK1G3(casein kinase 1, gamma 3) The peptide sequence was selected from the middle region of CSNK1G3. Peptide sequence LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
casein kinase 1, gamma 3, casein kinase I isoform gamma-3, CKI-gamma 3, EC 2.7.11, EC 2.7.11.1
CSNK1G3
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit