Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKI gamma 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CKI gamma 3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15757320
|
Novus Biologicals
NBP15757320UL |
20 μL |
Each for $152.22
|
|
NBP157573
|
Novus Biologicals
NBP157573 |
100 μL |
Each for $436.00
|
|
Description
CKI gamma 3 Polyclonal specifically detects CKI gamma 3 in Human samples. It is validated for Western Blot.Specifications
| CKI gamma 3 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| Q9Y6M4 | |
| 1456 | |
| Synthetic peptides corresponding to CSNK1G3(casein kinase 1, gamma 3) The peptide sequence was selected from the middle region of CSNK1G3. Peptide sequence LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| casein kinase 1, gamma 3, casein kinase I isoform gamma-3, CKI-gamma 3, EC 2.7.11, EC 2.7.11.1 | |
| CSNK1G3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title